PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5018_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 238aa    MW: 27261.4 Da    PI: 10.8725
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5018_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.89.5e-2192126135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 Cs+C tt+Tp+WR+gp+g+ktLCnaCG+++r+ +l
  RrC5018_p2  92 CSHCETTETPQWREGPNGPKTLCNACGVRFRSGRL 126
                 *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577166.18E-1684148No hitNo description
SMARTSM004016.5E-2086136IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.1186122IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.7E-1690123IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.52E-1791148No hitNo description
PfamPF003201.2E-1892126IPR000679Zinc finger, GATA-type
PROSITE patternPS00344092117IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MFQSLSPVSV LESSGRSFSP HNSRSQRLTS PVKGMRSKRK RPTTLRFKYL HQLEPSKPEN  60
FAPGGSGLKN YYDFEQHAKK KRRVSAKVAR ICSHCETTET PQWREGPNGP KTLCNACGVR  120
FRSGRLVPEY RPASSPTFVP SVHSNSHKKI IEMRRKEGAQ FHTSMIHGVH HVFAVIIIII  180
DEWVQTSATH LHIGRWFVPP NPSGRLFCKS FFGFFQRVEV EEPHWTLRLE CGILWILG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17882KKKRR
27883KKKRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895180.0AC189518.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB090M17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110913.11e-103PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP86e-79GAT11_ARATH; GATA transcription factor 11
TrEMBLM4EPI91e-103M4EPI9_BRARP; Uncharacterized protein
STRINGBra030709.1-P1e-102(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-71GATA transcription factor 11